Tesamorelin and Ipamorelin Blend 8mg (6mg/2mg)

Tesamorelin and Ipamorelin Blend 8mg (6mg/2mg) Description

The Tesamorelin and Ipamorelin Blend 8mg (6mg/2mg) combines a synthetic GHRH analogue with a selective growth hormone secretagogue, designed for laboratory research investigating growth hormone regulation pathways. This research compound enables the study of dual-mechanism growth hormone modulation, examining how Tesamorelin’s GHRH-mimicking properties interact with Ipamorelin’s selective ghrelin-like functions in experimental models.

This is a (8mg) blend each of Tesmorelin (6mg) and Ipamorelin (2mg).

Tesamorelin and Ipamorelin Blend 8mg (6mg/2mg) Peptide Structure

Tesamorelin

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

Synonyms:

• Tesamorelin acetate
• 901758-09-6
• TH9507
• UNII-LGW5H38VE3
• Tesamorelin acetate [USAN]

Ipamorelin

Sequence: Aib-His-D-2Nal-D-Phe-Lys

Molecular Formula: C₃₈H₄₉N₉O₅

Molecular Weight: 711.9 g/mol

PubChem CID: 9831659

CAS Number: 170851-70-4

Synonyms:

• 170851-70-4
• Ipamorelin [INN]
• NNC-26-0161
• UNII-Y9M3S784Z6

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.